PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 244aa    MW: 27641.6 Da    PI: 9.5631
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014380genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.53e-25143186144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+epgrCrRtDGKkWRCsr+v+ ++k+CErH+hrgr+rsrk++e
  Lus10014380 143 DPEPGRCRRTDGKKWRCSRDVVVNQKYCERHVHRGRNRSRKPVE 186
                  79***************************************998 PP

2QLQ52.61.4e-1870106137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  s+F+ aQ+q+L+ Q+l+y+y++a++ vPp+Ll +i+k
  Lus10014380  70 SYFSLAQWQELELQALIYRYMLAGASVPPQLLHPIKK 106
                  79*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.8E-1070106IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-1371104IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.3671106IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.995143187IPR014977WRC domain
PfamPF088792.1E-21144186IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDFHLKQWRN QHESEEEEQQ QQHNNLKMLL HPSSADDDNL QNPSAADAAA LPLFADSSTT  60
RFPTTRMGIS YFSLAQWQEL ELQALIYRYM LAGASVPPQL LHPIKKSLLL HTSSSPPSYF  120
LHNYPYPPSS LMQAGYWGRA AMDPEPGRCR RTDGKKWRCS RDVVVNQKYC ERHVHRGRNR  180
SRKPVEVTTP AARGGGFTPF FIARLAPAPF RSGPVLLDFL VLQEGKELQL QLICFTVIKG  240
KPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027646.11e-72Growth-regulating factor 3 isoform 2
SwissprotQ8L8A76e-55GRF4_ARATH; Growth-regulating factor 4
TrEMBLA0A061EU432e-72A0A061EU43_THECC; Growth-regulating factor 3 isoform 2
TrEMBLA0A0B0MN902e-72A0A0B0MN90_G
TrEMBLA0A0L9U8941e-72A0A0L9U894_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RZ531e-72A0A0S3RZ53_PHAAN; Uncharacterized protein
STRINGGLYMA03G35010.25e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78953242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.15e-39growth-regulating factor 3